PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00217g00912.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 449aa    MW: 47933.6 Da    PI: 5.2874
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00217g00912.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.53e-1398142347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE+ l++++ +++G g+W++I+r     Rt+ q+ s+ qk+
  Peaxi162Scf00217g00912.1  98 AWTAEEHRLFLQGLEKYGRGDWRSISRNCVVSRTPTQVASHAQKF 142
                               7***************************999************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.597161IPR017884SANT domain
SMARTSM007179.5E-4859IPR001005SANT/Myb domain
CDDcd001672.65E-51157No hitNo description
SuperFamilySSF466899.72E-91164IPR009057Homeodomain-like
PROSITE profilePS5129417.46891147IPR017930Myb domain
SuperFamilySSF466895.01E-1693148IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-1795145IPR006447Myb domain, plants
SMARTSM007178.2E-1195145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-1196138IPR009057Homeodomain-like
PfamPF002492.2E-1098141IPR001005SANT/Myb domain
CDDcd001671.27E-1098143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MSSDQTCNTS SWTKEEDRAF ETALAIYSGD SNQLMKIAAV VPQKSLREII QHYKDLVDDV  60
NDIEAGKVPI PEYTRMQSGS SHRSRLSGAE AARRKGVAWT AEEHRLFLQG LEKYGRGDWR  120
SISRNCVVSR TPTQVASHAQ KFFSRLNDVN KGKRRRSIHD ITTVDTDTIG PSQGQKSDKL  180
IGSYGGQLQW PITDYVTEAF GTGMLSLPGP VTNCSIGKIE GPSAVNPEKF PFGAAAVSGL  240
NSSLPDVDDE FVLGVDDLIT VPADGTSEAR CGGDTRTSPL LSLQPSIAGG TGLYTCPVNS  300
VGNQLGQVFT KQMVGAAELG PVVDTARLPW PNADHLGVHG CPASSIGAKN GFGSTVGAPE  360
GAFSVDSIAF PSIPGNIHGV YPGLNATIKE APEGGFLIDP KTLPSIPGTS RGVYTSLNST  420
IKDDNIFDLE DLFPDHIIKF HEKESIADS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631817.10.0PREDICTED: uncharacterized protein LOC104121509 isoform X1
RefseqXP_009631818.10.0PREDICTED: uncharacterized protein LOC104121509 isoform X1
RefseqXP_009631819.10.0PREDICTED: uncharacterized protein LOC104121509 isoform X2
RefseqXP_016467664.10.0PREDICTED: uncharacterized protein LOC107790243 isoform X1
RefseqXP_016467729.10.0PREDICTED: uncharacterized protein LOC107790243 isoform X2
TrEMBLA0A0V0J0A01e-135A0A0V0J0A0_SOLCH; Putative ovule protein
TrEMBLQ94GD41e-130Q94GD4_SOLDE; Putative I-box binding factor, identical
STRINGPGSC0003DMT4000481331e-129(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139501113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.17e-49MYB family protein